CSTF3 monoclonal antibody (M01), clone 1D4
  • CSTF3 monoclonal antibody (M01), clone 1D4

CSTF3 monoclonal antibody (M01), clone 1D4

Ref: AB-H00001479-M01
CSTF3 monoclonal antibody (M01), clone 1D4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CSTF3.
Información adicional
Size 100 ug
Gene Name CSTF3
Gene Alias CSTF-77|MGC117398|MGC43001|MGC75122
Gene Description cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1479
Clone Number 1D4
Iso type IgG1 kappa

Enviar uma mensagem


CSTF3 monoclonal antibody (M01), clone 1D4

CSTF3 monoclonal antibody (M01), clone 1D4