CSTF1 monoclonal antibody (M01), clone 1C6
  • CSTF1 monoclonal antibody (M01), clone 1C6

CSTF1 monoclonal antibody (M01), clone 1C6

Ref: AB-H00001477-M01
CSTF1 monoclonal antibody (M01), clone 1C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSTF1.
Información adicional
Size 100 ug
Gene Name CSTF1
Gene Alias CstF-50|CstFp50
Gene Description cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSTF1 (NP_001315.1, 332 a.a. ~ 431 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1477
Clone Number 1C6
Iso type IgG2a Kappa

Enviar uma mensagem


CSTF1 monoclonal antibody (M01), clone 1C6

CSTF1 monoclonal antibody (M01), clone 1C6