CSTA monoclonal antibody (M14), clone 4D8
  • CSTA monoclonal antibody (M14), clone 4D8

CSTA monoclonal antibody (M14), clone 4D8

Ref: AB-H00001475-M14
CSTA monoclonal antibody (M14), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CSTA.
Información adicional
Size 100 ug
Gene Name CSTA
Gene Alias STF1|STFA
Gene Description cystatin A (stefin A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSTA (AAH10379, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1475
Clone Number 4D8
Iso type IgG2a Kappa

Enviar uma mensagem


CSTA monoclonal antibody (M14), clone 4D8

CSTA monoclonal antibody (M14), clone 4D8