CST6 monoclonal antibody (M01), clone 2H8
  • CST6 monoclonal antibody (M01), clone 2H8

CST6 monoclonal antibody (M01), clone 2H8

Ref: AB-H00001474-M01
CST6 monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CST6.
Información adicional
Size 100 ug
Gene Name CST6
Gene Alias -
Gene Description cystatin E/M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CST6 (AAH31334, 29 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1474
Clone Number 2H8
Iso type IgG2a Kappa

Enviar uma mensagem


CST6 monoclonal antibody (M01), clone 2H8

CST6 monoclonal antibody (M01), clone 2H8