CST1 purified MaxPab mouse polyclonal antibody (B01P)
  • CST1 purified MaxPab mouse polyclonal antibody (B01P)

CST1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001469-B01P
CST1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CST1 protein.
Información adicional
Size 50 ug
Gene Name CST1
Gene Alias -
Gene Description cystatin SN
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CST1 (NP_001889.2, 1 a.a. ~ 141 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1469

Enviar uma mensagem


CST1 purified MaxPab mouse polyclonal antibody (B01P)

CST1 purified MaxPab mouse polyclonal antibody (B01P)