CSRP2 polyclonal antibody (A01)
  • CSRP2 polyclonal antibody (A01)

CSRP2 polyclonal antibody (A01)

Ref: AB-H00001466-A01
CSRP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CSRP2.
Información adicional
Size 50 uL
Gene Name CSRP2
Gene Alias CRP2|LMO5|SmLIM
Gene Description cysteine and glycine-rich protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSRP2 (AAH00992, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1466

Enviar uma mensagem


CSRP2 polyclonal antibody (A01)

CSRP2 polyclonal antibody (A01)