CSRP1 monoclonal antibody (M06), clone 2A11
  • CSRP1 monoclonal antibody (M06), clone 2A11

CSRP1 monoclonal antibody (M06), clone 2A11

Ref: AB-H00001465-M06
CSRP1 monoclonal antibody (M06), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSRP1.
Información adicional
Size 100 ug
Gene Name CSRP1
Gene Alias CRP|CRP1|CSRP|CYRP|D1S181E|DKFZp686M148
Gene Description cysteine and glycine-rich protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSRP1 (NP_004069, 94 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1465
Clone Number 2A11
Iso type IgG2a Kappa

Enviar uma mensagem


CSRP1 monoclonal antibody (M06), clone 2A11

CSRP1 monoclonal antibody (M06), clone 2A11