CSNK1G2 monoclonal antibody (M08), clone 2F5
  • CSNK1G2 monoclonal antibody (M08), clone 2F5

CSNK1G2 monoclonal antibody (M08), clone 2F5

Ref: AB-H00001455-M08
CSNK1G2 monoclonal antibody (M08), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSNK1G2.
Información adicional
Size 100 ug
Gene Name CSNK1G2
Gene Alias CK1g2
Gene Description casein kinase 1, gamma 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSNK1G2 (AAH18699, 315 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1455
Clone Number 2F5
Iso type IgG2a Kappa

Enviar uma mensagem


CSNK1G2 monoclonal antibody (M08), clone 2F5

CSNK1G2 monoclonal antibody (M08), clone 2F5