CSN2 polyclonal antibody (A01)
  • CSN2 polyclonal antibody (A01)

CSN2 polyclonal antibody (A01)

Ref: AB-H00001447-A01
CSN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CSN2.
Información adicional
Size 50 uL
Gene Name CSN2
Gene Alias CASB
Gene Description casein beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSN2 (NP_001882, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1447

Enviar uma mensagem


CSN2 polyclonal antibody (A01)

CSN2 polyclonal antibody (A01)