CSH2 purified MaxPab mouse polyclonal antibody (B01P)
  • CSH2 purified MaxPab mouse polyclonal antibody (B01P)

CSH2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001443-B01P
CSH2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CSH2 protein.
Información adicional
Size 50 ug
Gene Name CSH2
Gene Alias CS-2|CSB|hCS-B
Gene Description chorionic somatomammotropin hormone 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNVEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSH2 (AAH22044, 1 a.a. ~ 217 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1443

Enviar uma mensagem


CSH2 purified MaxPab mouse polyclonal antibody (B01P)

CSH2 purified MaxPab mouse polyclonal antibody (B01P)