CSF3 MaxPab rabbit polyclonal antibody (D01)
  • CSF3 MaxPab rabbit polyclonal antibody (D01)

CSF3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001440-D01
CSF3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CSF3 protein.
Información adicional
Size 100 uL
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSF3 (NP_000750.1, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1440

Enviar uma mensagem


CSF3 MaxPab rabbit polyclonal antibody (D01)

CSF3 MaxPab rabbit polyclonal antibody (D01)