CSF3 purified MaxPab mouse polyclonal antibody (B01P)
  • CSF3 purified MaxPab mouse polyclonal antibody (B01P)

CSF3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001440-B01P
CSF3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CSF3 protein.
Información adicional
Size 50 ug
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSF3 (NP_000750.1, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1440

Enviar uma mensagem


CSF3 purified MaxPab mouse polyclonal antibody (B01P)

CSF3 purified MaxPab mouse polyclonal antibody (B01P)