CSF1 polyclonal antibody (A01)
  • CSF1 polyclonal antibody (A01)

CSF1 polyclonal antibody (A01)

Ref: AB-H00001435-A01
CSF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CSF1.
Información adicional
Size 50 uL
Gene Name CSF1
Gene Alias MCSF|MGC31930
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSF1 (AAH21117, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1435

Enviar uma mensagem


CSF1 polyclonal antibody (A01)

CSF1 polyclonal antibody (A01)