View larger
Mouse monoclonal antibody raised against a partial recombinant MAPK14.
AB-H00001432-M01A
New product
MAPK14 monoclonal antibody (M01A), clone 3D5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | MAPK14 |
| Gene Alias | CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA |
| Gene Description | mitogen-activated protein kinase 14 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MAPK14 (AAH31574, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 1432 |
| Clone Number | 3D5 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant MAPK14.