CRYZ purified MaxPab rabbit polyclonal antibody (D01P)
  • CRYZ purified MaxPab rabbit polyclonal antibody (D01P)

CRYZ purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001429-D01P
CRYZ purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CRYZ protein.
Información adicional
Size 100 ug
Gene Name CRYZ
Gene Alias DKFZp779E0834|FLJ41475
Gene Description crystallin, zeta (quinone reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1429

Enviar uma mensagem


CRYZ purified MaxPab rabbit polyclonal antibody (D01P)

CRYZ purified MaxPab rabbit polyclonal antibody (D01P)