CRYZ polyclonal antibody (A01)
  • CRYZ polyclonal antibody (A01)

CRYZ polyclonal antibody (A01)

Ref: AB-H00001429-A01
CRYZ polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRYZ.
Información adicional
Size 50 uL
Gene Name CRYZ
Gene Alias DKFZp779E0834|FLJ41475
Gene Description crystallin, zeta (quinone reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYZ (NP_001880, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1429

Enviar uma mensagem


CRYZ polyclonal antibody (A01)

CRYZ polyclonal antibody (A01)