CRYM MaxPab rabbit polyclonal antibody (D01)
  • CRYM MaxPab rabbit polyclonal antibody (D01)

CRYM MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001428-D01
CRYM MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CRYM protein.
Información adicional
Size 100 uL
Gene Name CRYM
Gene Alias DFNA40|THBP
Gene Description crystallin, mu
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRYM (NP_001879.1, 1 a.a. ~ 314 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1428

Enviar uma mensagem


CRYM MaxPab rabbit polyclonal antibody (D01)

CRYM MaxPab rabbit polyclonal antibody (D01)