CRYGC monoclonal antibody (M01), clone 7C4
  • CRYGC monoclonal antibody (M01), clone 7C4

CRYGC monoclonal antibody (M01), clone 7C4

Ref: AB-H00001420-M01
CRYGC monoclonal antibody (M01), clone 7C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRYGC.
Información adicional
Size 100 ug
Gene Name CRYGC
Gene Alias CCL|CRYG3
Gene Description crystallin, gamma C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYGC (NP_066269, 75 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1420
Clone Number 7C4
Iso type IgG2a Kappa

Enviar uma mensagem


CRYGC monoclonal antibody (M01), clone 7C4

CRYGC monoclonal antibody (M01), clone 7C4