CRYBB3 monoclonal antibody (M01), clone 4H6
  • CRYBB3 monoclonal antibody (M01), clone 4H6

CRYBB3 monoclonal antibody (M01), clone 4H6

Ref: AB-H00001417-M01
CRYBB3 monoclonal antibody (M01), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRYBB3.
Información adicional
Size 100 ug
Gene Name CRYBB3
Gene Alias CATCN2|CRYB3|MGC125772|MGC125773|MGC125774
Gene Description crystallin, beta B3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq PHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYBB3 (NP_004067.1, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1417
Clone Number 4H6
Iso type IgG2a Kappa

Enviar uma mensagem


CRYBB3 monoclonal antibody (M01), clone 4H6

CRYBB3 monoclonal antibody (M01), clone 4H6