CRYBB1 monoclonal antibody (M03), clone 3D9
  • CRYBB1 monoclonal antibody (M03), clone 3D9

CRYBB1 monoclonal antibody (M03), clone 3D9

Ref: AB-H00001414-M03
CRYBB1 monoclonal antibody (M03), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRYBB1.
Información adicional
Size 100 ug
Gene Name CRYBB1
Gene Alias CATCN3
Gene Description crystallin, beta B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYBB1 (NP_001878, 37 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1414
Clone Number 3D9
Iso type IgG2b Kappa

Enviar uma mensagem


CRYBB1 monoclonal antibody (M03), clone 3D9

CRYBB1 monoclonal antibody (M03), clone 3D9