CRYBB1 polyclonal antibody (A01)
  • CRYBB1 polyclonal antibody (A01)

CRYBB1 polyclonal antibody (A01)

Ref: AB-H00001414-A01
CRYBB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRYBB1.
Información adicional
Size 50 uL
Gene Name CRYBB1
Gene Alias CATCN3
Gene Description crystallin, beta B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYBB1 (NP_001878, 37 a.a. ~ 137 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1414

Enviar uma mensagem


CRYBB1 polyclonal antibody (A01)

CRYBB1 polyclonal antibody (A01)