CRYBA4 monoclonal antibody (M01), clone 1D7
  • CRYBA4 monoclonal antibody (M01), clone 1D7

CRYBA4 monoclonal antibody (M01), clone 1D7

Ref: AB-H00001413-M01
CRYBA4 monoclonal antibody (M01), clone 1D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRYBA4.
Información adicional
Size 100 ug
Gene Name CRYBA4
Gene Alias -
Gene Description crystallin, beta A4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYBA4 (NP_001877, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1413
Clone Number 1D7
Iso type IgG2a Kappa

Enviar uma mensagem


CRYBA4 monoclonal antibody (M01), clone 1D7

CRYBA4 monoclonal antibody (M01), clone 1D7