CRX monoclonal antibody (M04), clone 6D11
  • CRX monoclonal antibody (M04), clone 6D11

CRX monoclonal antibody (M04), clone 6D11

Ref: AB-H00001406-M04
CRX monoclonal antibody (M04), clone 6D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRX.
Información adicional
Size 100 ug
Gene Name CRX
Gene Alias CORD2|CRD|LCA7|OTX3
Gene Description cone-rod homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1406
Clone Number 6D11
Iso type IgG2a Kappa

Enviar uma mensagem


CRX monoclonal antibody (M04), clone 6D11

CRX monoclonal antibody (M04), clone 6D11