CRP purified MaxPab mouse polyclonal antibody (B02P)
  • CRP purified MaxPab mouse polyclonal antibody (B02P)

CRP purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001401-B02P
CRP purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CRP protein.
Información adicional
Size 50 ug
Gene Name CRP
Gene Alias MGC149895|MGC88244|PTX1
Gene Description C-reactive protein, pentraxin-related
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRP (ENSP00000357093, 1 a.a. ~ 91 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1401

Enviar uma mensagem


CRP purified MaxPab mouse polyclonal antibody (B02P)

CRP purified MaxPab mouse polyclonal antibody (B02P)