CRKL purified MaxPab rabbit polyclonal antibody (D01P)
  • CRKL purified MaxPab rabbit polyclonal antibody (D01P)

CRKL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001399-D01P
CRKL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CRKL protein.
Información adicional
Size 100 ug
Gene Name CRKL
Gene Alias -
Gene Description v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce,IF
Immunogen Prot. Seq MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRKL (NP_005198.1, 1 a.a. ~ 303 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1399

Enviar uma mensagem


CRKL purified MaxPab rabbit polyclonal antibody (D01P)

CRKL purified MaxPab rabbit polyclonal antibody (D01P)