CREM MaxPab mouse polyclonal antibody (B01P)
  • CREM MaxPab mouse polyclonal antibody (B01P)

CREM MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001390-B01P
CREM MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CREM protein.
Información adicional
Size 50 ug
Gene Name CREM
Gene Alias ICER|MGC111110|MGC17881|MGC41893|hCREM-2
Gene Description cAMP responsive element modulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CREM (NP_001872.3, 1 a.a. ~ 137 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1390

Enviar uma mensagem


CREM MaxPab mouse polyclonal antibody (B01P)

CREM MaxPab mouse polyclonal antibody (B01P)