CREBL1 monoclonal antibody (M02), clone 4D10
  • CREBL1 monoclonal antibody (M02), clone 4D10

CREBL1 monoclonal antibody (M02), clone 4D10

Ref: AB-H00001388-M02
CREBL1 monoclonal antibody (M02), clone 4D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREBL1.
Información adicional
Size 100 ug
Gene Name ATF6B
Gene Alias CREB-RP|CREBL1|FLJ10066|G13
Gene Description activating transcription factor 6 beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREBL1 (NP_004372.3, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1388
Clone Number 4D10
Iso type IgG2a Kappa

Enviar uma mensagem


CREBL1 monoclonal antibody (M02), clone 4D10

CREBL1 monoclonal antibody (M02), clone 4D10