ATF2 monoclonal antibody (M15), clone 4A3
  • ATF2 monoclonal antibody (M15), clone 4A3

ATF2 monoclonal antibody (M15), clone 4A3

Ref: AB-H00001386-M15
ATF2 monoclonal antibody (M15), clone 4A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ATF2.
Información adicional
Size 100 ug
Gene Name ATF2
Gene Alias CRE-BP1|CREB2|HB16|MGC111558|TREB7
Gene Description activating transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATF2 (NP_001871, 241 a.a. ~ 340 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1386
Clone Number 4A3
Iso type IgG1 Kappa

Enviar uma mensagem


ATF2 monoclonal antibody (M15), clone 4A3

ATF2 monoclonal antibody (M15), clone 4A3