CREB1 monoclonal antibody (M08), clone 2B2
  • CREB1 monoclonal antibody (M08), clone 2B2

CREB1 monoclonal antibody (M08), clone 2B2

Ref: AB-H00001385-M08
CREB1 monoclonal antibody (M08), clone 2B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREB1.
Información adicional
Size 100 ug
Gene Name CREB1
Gene Alias CREB|MGC9284
Gene Description cAMP responsive element binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREB1 (AAH10636.1, 14 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1385
Clone Number 2B2
Iso type IgG2a Kappa

Enviar uma mensagem


CREB1 monoclonal antibody (M08), clone 2B2

CREB1 monoclonal antibody (M08), clone 2B2