CRAT polyclonal antibody (A01)
  • CRAT polyclonal antibody (A01)

CRAT polyclonal antibody (A01)

Ref: AB-H00001384-A01
CRAT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRAT.
Información adicional
Size 50 uL
Gene Name CRAT
Gene Alias CAT1
Gene Description carnitine acetyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq AIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRAT (NP_659006, 445 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1384

Enviar uma mensagem


CRAT polyclonal antibody (A01)

CRAT polyclonal antibody (A01)