CPT2 monoclonal antibody (M02), clone 1G7
  • CPT2 monoclonal antibody (M02), clone 1G7

CPT2 monoclonal antibody (M02), clone 1G7

Ref: AB-H00001376-M02
CPT2 monoclonal antibody (M02), clone 1G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPT2.
Información adicional
Size 100 ug
Gene Name CPT2
Gene Alias CPT1|CPTASE
Gene Description carnitine palmitoyltransferase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPT2 (AAH05172, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1376
Clone Number 1G7
Iso type IgG2b Kappa

Enviar uma mensagem


CPT2 monoclonal antibody (M02), clone 1G7

CPT2 monoclonal antibody (M02), clone 1G7