CPA3 purified MaxPab mouse polyclonal antibody (B01P)
  • CPA3 purified MaxPab mouse polyclonal antibody (B01P)

CPA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001359-B01P
CPA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CPA3 protein.
Información adicional
Size 50 ug
Gene Name CPA3
Gene Alias -
Gene Description carboxypeptidase A3 (mast cell)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFMDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPA3 (NP_001861.1, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1359

Enviar uma mensagem


CPA3 purified MaxPab mouse polyclonal antibody (B01P)

CPA3 purified MaxPab mouse polyclonal antibody (B01P)