CPA2 monoclonal antibody (M02), clone 2E11
  • CPA2 monoclonal antibody (M02), clone 2E11

CPA2 monoclonal antibody (M02), clone 2E11

Ref: AB-H00001358-M02
CPA2 monoclonal antibody (M02), clone 2E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPA2.
Información adicional
Size 100 ug
Gene Name CPA2
Gene Alias -
Gene Description carboxypeptidase A2 (pancreatic)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1358
Clone Number 2E11
Iso type IgG2b Kappa

Enviar uma mensagem


CPA2 monoclonal antibody (M02), clone 2E11

CPA2 monoclonal antibody (M02), clone 2E11