CPA1 MaxPab rabbit polyclonal antibody (D01)
  • CPA1 MaxPab rabbit polyclonal antibody (D01)

CPA1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001357-D01
CPA1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CPA1 protein.
Información adicional
Size 100 uL
Gene Name CPA1
Gene Alias CPA
Gene Description carboxypeptidase A1 (pancreatic)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPA1 (NP_001859.1, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1357

Enviar uma mensagem


CPA1 MaxPab rabbit polyclonal antibody (D01)

CPA1 MaxPab rabbit polyclonal antibody (D01)