COX6C monoclonal antibody (M01), clone 4G4-2A8
  • COX6C monoclonal antibody (M01), clone 4G4-2A8

COX6C monoclonal antibody (M01), clone 4G4-2A8

Ref: AB-H00001345-M01
COX6C monoclonal antibody (M01), clone 4G4-2A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant COX6C.
Información adicional
Size 100 ug
Gene Name COX6C
Gene Alias -
Gene Description cytochrome c oxidase subunit VIc
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1345
Clone Number 4G4-2A8
Iso type IgG1 kappa

Enviar uma mensagem


COX6C monoclonal antibody (M01), clone 4G4-2A8

COX6C monoclonal antibody (M01), clone 4G4-2A8