CORT monoclonal antibody (M01), clone 8G10
  • CORT monoclonal antibody (M01), clone 8G10

CORT monoclonal antibody (M01), clone 8G10

Ref: AB-H00001325-M01
CORT monoclonal antibody (M01), clone 8G10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CORT.
Información adicional
Size 100 ug
Gene Name CORT
Gene Alias CST-14|CST-17|CST-29
Gene Description cortistatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEKLQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORT (NP_001293.2, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1325
Clone Number 8G10
Iso type IgG2b Kappa

Enviar uma mensagem


CORT monoclonal antibody (M01), clone 8G10

CORT monoclonal antibody (M01), clone 8G10