COPA polyclonal antibody (A01)
  • COPA polyclonal antibody (A01)

COPA polyclonal antibody (A01)

Ref: AB-H00001314-A01
COPA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COPA.
Información adicional
Size 50 uL
Gene Name COPA
Gene Alias FLJ26320|HEP-COP
Gene Description coatomer protein complex, subunit alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPA (NP_004362, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1314

Enviar uma mensagem


COPA polyclonal antibody (A01)

COPA polyclonal antibody (A01)