COMT polyclonal antibody (A01)
  • COMT polyclonal antibody (A01)

COMT polyclonal antibody (A01)

Ref: AB-H00001312-A01
COMT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant COMT.
Información adicional
Size 50 uL
Gene Name COMT
Gene Alias -
Gene Description catechol-O-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COMT (AAH00419.2, 1 a.a. ~ 182 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1312

Enviar uma mensagem


COMT polyclonal antibody (A01)

COMT polyclonal antibody (A01)