COL19A1 polyclonal antibody (A01)
  • COL19A1 polyclonal antibody (A01)

COL19A1 polyclonal antibody (A01)

Ref: AB-H00001310-A01
COL19A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL19A1.
Información adicional
Size 50 uL
Gene Name COL19A1
Gene Alias COL9A1L|D6S228E
Gene Description collagen, type XIX, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL19A1 (NP_001849, 27 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1310

Enviar uma mensagem


COL19A1 polyclonal antibody (A01)

COL19A1 polyclonal antibody (A01)