COL9A3 monoclonal antibody (M02A), clone 2B5
  • COL9A3 monoclonal antibody (M02A), clone 2B5

COL9A3 monoclonal antibody (M02A), clone 2B5

Ref: AB-H00001299-M02A
COL9A3 monoclonal antibody (M02A), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COL9A3.
Información adicional
Size 200 uL
Gene Name COL9A3
Gene Alias DJ885L7.4.1|EDM3|FLJ90759|IDD|MED
Gene Description collagen, type IX, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL9A3 (NP_001844, 280 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1299
Clone Number 2B5
Iso type IgM Kappa

Enviar uma mensagem


COL9A3 monoclonal antibody (M02A), clone 2B5

COL9A3 monoclonal antibody (M02A), clone 2B5