COL9A3 polyclonal antibody (A01)
  • COL9A3 polyclonal antibody (A01)

COL9A3 polyclonal antibody (A01)

Ref: AB-H00001299-A01
COL9A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL9A3.
Información adicional
Size 50 uL
Gene Name COL9A3
Gene Alias DJ885L7.4.1|EDM3|FLJ90759|IDD|MED
Gene Description collagen, type IX, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL9A3 (NP_001844, 280 a.a. ~ 338 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1299

Enviar uma mensagem


COL9A3 polyclonal antibody (A01)

COL9A3 polyclonal antibody (A01)