COL9A1 polyclonal antibody (A01)
  • COL9A1 polyclonal antibody (A01)

COL9A1 polyclonal antibody (A01)

Ref: AB-H00001297-A01
COL9A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL9A1.
Información adicional
Size 50 uL
Gene Name COL9A1
Gene Alias DJ149L1.1.2|EDM6|FLJ40263|MED
Gene Description collagen, type IX, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL9A1 (NP_001842, 24 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1297

Enviar uma mensagem


COL9A1 polyclonal antibody (A01)

COL9A1 polyclonal antibody (A01)