CNN2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CNN2 purified MaxPab rabbit polyclonal antibody (D01P)

CNN2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001265-D01P
CNN2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CNN2 protein.
Información adicional
Size 100 ug
Gene Name CNN2
Gene Alias -
Gene Description calponin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNN2 (NP_958434.1, 1 a.a. ~ 270 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1265

Enviar uma mensagem


CNN2 purified MaxPab rabbit polyclonal antibody (D01P)

CNN2 purified MaxPab rabbit polyclonal antibody (D01P)