PLK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PLK3 purified MaxPab rabbit polyclonal antibody (D01P)

PLK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001263-D01P
PLK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLK3 protein.
Información adicional
Size 100 ug
Gene Name PLK3
Gene Alias CNK|FNK|PRK
Gene Description polo-like kinase 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLK3 (NP_004064.2, 1 a.a. ~ 646 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1263

Enviar uma mensagem


PLK3 purified MaxPab rabbit polyclonal antibody (D01P)

PLK3 purified MaxPab rabbit polyclonal antibody (D01P)