Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ABCC2 monoclonal antibody (M01A), clone 1C5
Abnova
ABCC2 monoclonal antibody (M01A), clone 1C5
Ref: AB-H00001244-M01A
ABCC2 monoclonal antibody (M01A), clone 1C5
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ABCC2.
Información adicional
Size
200 uL
Gene Name
ABCC2
Gene Alias
ABC30|CMOAT|DJS|KIAA1010|MRP2|cMRP
Gene Description
ATP-binding cassette, sub-family C (CFTR/MRP), member 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ABCC2 (NP_000383, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
1244
Clone Number
1C5
Iso type
IgG1 Kappa
Enviar uma mensagem
ABCC2 monoclonal antibody (M01A), clone 1C5
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*