CLTC monoclonal antibody (M05), clone 2E5
  • CLTC monoclonal antibody (M05), clone 2E5

CLTC monoclonal antibody (M05), clone 2E5

Ref: AB-H00001213-M05
CLTC monoclonal antibody (M05), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLTC.
Información adicional
Size 50 ug
Gene Name CLTC
Gene Alias CHC|CHC17|CLH-17|CLTCL2|Hc|KIAA0034
Gene Description clathrin, heavy chain (Hc)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1213
Clone Number 2E5
Iso type IgG2a Kappa

Enviar uma mensagem


CLTC monoclonal antibody (M05), clone 2E5

CLTC monoclonal antibody (M05), clone 2E5