CLTA purified MaxPab rabbit polyclonal antibody (D01P)
  • CLTA purified MaxPab rabbit polyclonal antibody (D01P)

CLTA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001211-D01P
CLTA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CLTA protein.
Información adicional
Size 100 ug
Gene Name CLTA
Gene Alias LCA
Gene Description clathrin, light chain (Lca)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLTA (NP_001824.1, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1211

Enviar uma mensagem


CLTA purified MaxPab rabbit polyclonal antibody (D01P)

CLTA purified MaxPab rabbit polyclonal antibody (D01P)