CLPS monoclonal antibody (M01), clone 8A8
  • CLPS monoclonal antibody (M01), clone 8A8

CLPS monoclonal antibody (M01), clone 8A8

Ref: AB-H00001208-M01
CLPS monoclonal antibody (M01), clone 8A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLPS.
Información adicional
Size 100 ug
Gene Name CLPS
Gene Alias -
Gene Description colipase, pancreatic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLPS (NP_001823, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1208
Clone Number 8A8
Iso type IgG2a Kappa

Enviar uma mensagem


CLPS monoclonal antibody (M01), clone 8A8

CLPS monoclonal antibody (M01), clone 8A8