TPP1 monoclonal antibody (M01J), clone 3B1
  • TPP1 monoclonal antibody (M01J), clone 3B1

TPP1 monoclonal antibody (M01J), clone 3B1

Ref: AB-H00001200-M01J
TPP1 monoclonal antibody (M01J), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPP1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name TPP1
Gene Alias CLN2|GIG1|LPIC|MGC21297
Gene Description tripeptidyl peptidase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPP1 (AAH14863.1, 195 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1200
Clone Number 3B1
Iso type IgG1 Kappa

Enviar uma mensagem


TPP1 monoclonal antibody (M01J), clone 3B1

TPP1 monoclonal antibody (M01J), clone 3B1