TPP1 MaxPab rabbit polyclonal antibody (D01)
  • TPP1 MaxPab rabbit polyclonal antibody (D01)

TPP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001200-D01
TPP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPP1 protein.
Información adicional
Size 100 uL
Gene Name TPP1
Gene Alias CLN2|GIG1|LPIC|MGC21297
Gene Description tripeptidyl peptidase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPP1 (NP_000382.3, 1 a.a. ~ 563 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1200

Enviar uma mensagem


TPP1 MaxPab rabbit polyclonal antibody (D01)

TPP1 MaxPab rabbit polyclonal antibody (D01)